PDB entry 1oay

View 1oay on RCSB PDB site
Description: Antibody multispecificity mediated by conformational diversity
Class: immune system
Keywords: immune system, antibody-complex, antibody, allergy, ige, conformational diversity, multispecificity
Deposited on 2003-01-21, released 2004-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.226
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAY (Start-121)
    Domains in SCOPe 2.05: d1oayh_
  • Chain 'I':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAY
  • Chain 'J':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAY (Start-121)
    Domains in SCOPe 2.05: d1oayj_
  • Chain 'K':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAY
  • Chain 'L':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAY
    Domains in SCOPe 2.05: d1oayl_
  • Chain 'M':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAY
    Domains in SCOPe 2.05: d1oaym_
  • Chain 'N':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAY
    Domains in SCOPe 2.05: d1oayn_
  • Chain 'O':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAY
    Domains in SCOPe 2.05: d1oayo_
  • Heterogens: FUR, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1oayH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nlkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oayH (H:)
    vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkyn
    lkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvssa
    a
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1oayJ (J:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nlkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oayJ (J:)
    vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtkyn
    lkfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvssa
    a
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oayL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oayL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1oayM (M:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oayM (M:)
    avvtqesalttspgetvtltcrsstavtanwvqekprhlftglinnrvparfsgslignk
    aaltitgaqtedeaiyfcavfgggt
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1oayN (N:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oayN (N:)
    avvtesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgvpa
    rfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1oayO (O:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekprhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oayO (O:)
    avvtqesalttspgetvtltcrsstavtnwvqekprhlftgliggtnnraparfsgslig
    nkaaltitgaqtedeaiyfcavfgggtkltvl