PDB entry 1oau

View 1oau on RCSB PDB site
Description: Fv Structure of the IgE SPE-7 in complex with DNP-Ser (immunising hapten)
Deposited on 2003-01-21, released 2004-01-15
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-15, with a file datestamp of 2004-01-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.226
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.67: d1oauh_
  • Chain 'I':
    Domains in SCOP 1.67: d1oaui_
  • Chain 'J':
    Domains in SCOP 1.67: d1oauj_
  • Chain 'K':
    Domains in SCOP 1.67: d1oauk_
  • Chain 'L':
    Domains in SCOP 1.67: d1oaul_
  • Chain 'M':
    Domains in SCOP 1.67: d1oaum_
  • Chain 'N':
    Domains in SCOP 1.67: d1oaun_
  • Chain 'O':
    Domains in SCOP 1.67: d1oauo_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oauH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1oauI (I:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauI (I:)
    gavkhrpamvyycarmfgttvs
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oauJ (J:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1oauK (K:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauK (K:)
    gavkrpamvyycarmdwgttvs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oauL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1oauM (M:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauM (M:)
    qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftglignnrapgvparfsgs
    lignkaaltitgaqtedeaiyfcgtkltvl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1oauN (N:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauN (N:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1oauO (O:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oauO (O:)
    qesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvparfs
    gslignkaaltitgaqtedeaiyfcgtkltvl