PDB entry 1oar

View 1oar on RCSB PDB site
Description: Fv IgE SPE-7 in complex with Alizarin Red
Class: immune system
Keywords: immune system, antibody-complex, antibody, allergy, ige, conformational diversity, multispecificity
Deposited on 2003-01-21, released 2004-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAR (0-121)
    Domains in SCOPe 2.05: d1oarh_
  • Chain 'I':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAR
    Domains in SCOPe 2.05: d1oari_
  • Chain 'J':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAR (0-121)
    Domains in SCOPe 2.05: d1oarj_
  • Chain 'K':
    Compound: immunoglobulin e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAR
    Domains in SCOPe 2.05: d1oark_
  • Chain 'L':
    Compound: immunoglobuling e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAR
    Domains in SCOPe 2.05: d1oarl_
  • Chain 'M':
    Compound: immunoglobuling e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAR
    Domains in SCOPe 2.05: d1oarm_
  • Chain 'N':
    Compound: immunoglobuling e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAR
    Domains in SCOPe 2.05: d1oarn_
  • Chain 'O':
    Compound: immunoglobuling e
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OAR
    Domains in SCOPe 2.05: d1oaro_
  • Heterogens: CAC, DMS, EDO, AZN, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oarH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1oarI (I:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oarI (I:)
    pgasvklsckasgytftsywmhwvkqrlewigridgtkynekfkskatltvstaymqlss
    ldsavyycarmwyygtyyfdywgqgttl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oarJ (J:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1oarK (K:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    aa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oarK (K:)
    pgasvklscktsywmhwvkqrlewigridgtkynekfkskatltvstaymqlssldsavy
    ycarmwyygtyyfdywgqgttl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1oarL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oarL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1oarM (M:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oarM (M:)
    vvtqesalttspgetvtltcravttsnyanwvqekpdhlftgliggtnnrapgvparfsg
    slignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1oarN (N:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oarN (N:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1oarO (O:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oarO (O:)
    vvtqesalttspgetvtltcrsstavttsnyanwvqekpdhlftgliggtnnrapgvpar
    fsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvl