PDB entry 1oao

View 1oao on RCSB PDB site
Description: nizn[fe4s4] and nini[fe4s4] clusters in closed and open alpha subunits of acetyl-coa synthase/carbon monoxide dehydrogenase
Deposited on 2003-01-20, released 2003-04-11
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-11, with a file datestamp of 2003-04-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.14856
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1oaoa_
  • Chain 'B':
    Domains in SCOP 1.65: d1oaob_
  • Chain 'C':
    Domains in SCOP 1.65: d1oaoc_
  • Chain 'D':
    Domains in SCOP 1.65: d1oaod_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oaoA (A:)
    mprfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqck
    igyegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhi
    ahalvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkge
    geatwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvala
    dytgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremeg
    eakaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsi
    savaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyi
    pqiknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdns
    hltvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieig
    lppvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgv
    pthvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhk
    evaeryetklcqgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oaoA (A:)
    prfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqcki
    gyegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhia
    halvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkgeg
    eatwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvalad
    ytgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremege
    akaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsis
    avaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyip
    qiknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdnsh
    ltvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieigl
    ppvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgvp
    thvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhke
    vaeryetklcqgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1oaoB (B:)
    mprfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqck
    igyegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhi
    ahalvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkge
    geatwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvala
    dytgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremeg
    eakaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsi
    savaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyi
    pqiknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdns
    hltvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieig
    lppvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgv
    pthvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhk
    evaeryetklcqgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oaoB (B:)
    prfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqcki
    gyegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhia
    halvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkgeg
    eatwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvalad
    ytgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremege
    akaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsis
    avaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyip
    qiknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdnsh
    ltvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieigl
    ppvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgvp
    thvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhke
    vaeryetklcqgy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oaoC (C:)
    mtdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtay
    ylpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylk
    ykpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmg
    fmlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeq
    rdyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydk
    ivqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsese
    itdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwht
    gqrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymev
    arekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasy
    einhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfea
    imailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisa
    dggiarivwmpkslkdflhdefvrrsveeglgedfidkiadetigttvdeilpyleekgh
    paltmdpim
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1oaoD (D:)
    mtdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtay
    ylpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylk
    ykpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmg
    fmlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeq
    rdyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydk
    ivqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsese
    itdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwht
    gqrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymev
    arekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasy
    einhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfea
    imailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisa
    dggiarivwmpkslkdflhdefvrrsveeglgedfidkiadetigttvdeilpyleekgh
    paltmdpim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oaoD (D:)
    tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy
    lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky
    kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf
    mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr
    dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki
    vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei
    tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg
    qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva
    rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye
    inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai
    mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad
    ggiarivwmpkslkdflhdefvrrsveeglgedfidkiadetigttvdeilpyleekghp
    altmdpim