PDB entry 1oal

View 1oal on RCSB PDB site
Description: active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
Class: oxidoreductase
Keywords: oxidoreductase, prokaryotic cu, zn superoxide dismutase, protein-subunit interaction recognition, protein electrostatic
Deposited on 2003-01-15, released 2003-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.159
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Photobacterium leiognathi [TaxId:658]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00446 (0-150)
      • conflict (30)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d1oala_
  • Heterogens: ZN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oalA (A:)
    qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgehgfhihqngscassekdgk
    vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
    aimihaggdnhsdmpkalggggarvacgviq