PDB entry 1oak

View 1oak on RCSB PDB site
Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab
Deposited on 1997-12-18, released 1998-10-21
The last revision prior to the SCOP 1.59 freeze date was dated 1998-10-21, with a file datestamp of 1998-10-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oakA (A:)
    mycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshayi
    glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
    pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
    rdeivsylcdlapeap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1oakH (H:)
    qvqlaesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
    salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oakH (H:)
    qvqlaesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
    salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
    ssakttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oakL (L:)
    diqmtqspsslsaslgdrvtiscsasqdinkylnwyqqkpdgavkllifytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqyeklpwtfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn