PDB entry 1oak

View 1oak on RCSB PDB site
Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab
Class: complex (willebrand/immunoglobulin)
Keywords: von willebrand factor, glycoprotein iba (a:alpha) binding, complex (willebrand/immunoglobulin), blood coagulation
Deposited on 1997-12-18, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oaka_
  • Chain 'H':
    Compound: nmc-4 igg1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB49724 (8-217)
    Domains in SCOPe 2.07: d1oakh1, d1oakh2
  • Chain 'L':
    Compound: nmc-4 igg1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB49725 (8-207)
    Domains in SCOPe 2.07: d1oakl1, d1oakl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oakA (A:)
    mycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshayi
    glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
    pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
    rdeivsylcdlapeap
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1oakH (H:)
    qvqlaesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
    salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oakH (H:)
    qvqlaesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
    salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
    ssakttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oakL (L:)
    diqmtqspsslsaslgdrvtiscsasqdinkylnwyqqkpdgavkllifytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqyeklpwtfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn