PDB entry 1oaa

View 1oaa on RCSB PDB site
Description: mouse sepiapterin reductase complexed with nadp and oxaloacetate
Class: oxidoreductase
Keywords: sepiapterin reductase, tetrahydrobiopterin, oxidoreductase
Deposited on 1997-08-25, released 1999-02-16
The last revision prior to the SCOP 1.73 freeze date was dated 1999-02-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.2
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sepiapterin reductase
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1oaaa_
  • Heterogens: SO4, OAA, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1oaaA (A:)
adglgcavcvltgasrgfgralapqlarllspgsvmlvsarsesmlrqlkeelgaqqpdl
kvvlaaadlgteagvqrllsavrelprpeglqrlllinnaatlgdvskgflnvndlaevn
nywalnltsmlcltsgtlnafqdspglsktvvnisslcalqpykgwglycagkaardmly
qvlaaeepsvrvlsyapgpldndmqqlaretskdpelrsklqklksdgalvdcgtsaqkl
lgllqkdtfqsgahvdfyd