PDB entry 1o9u

View 1o9u on RCSB PDB site
Description: glycogen synthase kinase 3 beta complexed with axin peptide
Class: transferase/transferase substrate
Keywords: transferase-transferase substrate complex, kinase, insulin pathway, transferase, serine/threonine-protein kinase, ATP-binding, multigene family, phosphorylation, developmental protein, anti-oncogene, apoptosis, transferase- transferase substrate complex
Deposited on 2002-12-19, released 2003-08-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.233
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841 (0-349)
      • conflict (315)
    Domains in SCOPe 2.03: d1o9ua_
  • Chain 'B':
    Compound: axin peptide
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o9uA (A:)
    skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqgkafk
    nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpatvyrvarhysrakqtlp
    viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
    syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
    tptreqiremnpnytefafpqikahpwtkvfrprtppeaialcsrlleytptarltplea
    cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'B':
    No sequence available.