PDB entry 1o9u

View 1o9u on RCSB PDB site
Description: glycogen synthase kinase 3 beta complexed with axin peptide
Class: kinase
Keywords: kinase, insulin pathway, transferase, serine/threonine -protein kinase; ATP-binding, multigene family, phosphorylation; alternative splicing, developmental protein, phosphorylation, anti-oncogene, apoptosis
Deposited on 2002-12-19, released 2003-08-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-08-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.233
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49841 (0-349)
      • conflict (315)
    Domains in SCOP 1.75: d1o9ua_
  • Chain 'B':
    Compound: axin peptide
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1o9uA (A:)
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqgkafk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpatvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefafpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

  • Chain 'B':
    No sequence available.