PDB entry 1o9t

View 1o9t on RCSB PDB site
Description: methionine adenosyltransferase complexed with both substrates ATP and methionine
Class: transferase
Keywords: transferase, adenosyltransferase, ATP binding, methionine binding, one-carbon metabolism, magnesium, potassium, metal-binding, multigene family, ATP-binding
Deposited on 2002-12-18, released 2003-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.265
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylmethionine synthetase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o9ta1, d1o9ta2, d1o9ta3
  • Chain 'B':
    Compound: s-adenosylmethionine synthetase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o9tb1, d1o9tb2, d1o9tb3
  • Heterogens: MET, PO4, MG, K, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o9tA (A:)
    mngpvdglcdhslseegafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetv
    cktgmvllcgeitsmamidyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspdiaq
    cvhldrneedvgagdqglmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpd
    sktqvtvqyvqdngavipvrvhtivisvqhneditleamrealkeqvikavvpakylded
    tiyhlqpsgrfviggpqgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaar
    wvakslvkaglcrrvlvqvsyaigvaeplsisiftygtskkterellevvnknfdlrpgv
    ivrdldlkkpiyqktacyghfgrsefpwevpkklvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9tA (A:)
    gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
    midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspedvgagdqglmfgyatdete
    ecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvqyvqdngavipvrvhtivisv
    qhneditleamrealkeqvikavvpakyldedtiyhlqpsgrfviggpqgdagvtgrkii
    vdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglcrrvlvqvsyaigvaep
    lsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiyqktacyghfgrsefpw
    evpkklvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o9tB (B:)
    mngpvdglcdhslseegafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetv
    cktgmvllcgeitsmamidyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspdiaq
    cvhldrneedvgagdqglmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpd
    sktqvtvqyvqdngavipvrvhtivisvqhneditleamrealkeqvikavvpakylded
    tiyhlqpsgrfviggpqgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaar
    wvakslvkaglcrrvlvqvsyaigvaeplsisiftygtskkterellevvnknfdlrpgv
    ivrdldlkkpiyqktacyghfgrsefpwevpkklvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o9tB (B:)
    gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
    midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspedvgagdqglmfgyatdete
    ecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvqyvqdngavipvrvhtivisv
    qhneditleamrealkeqvikavvpakyldedtiyhlqpsgrfviggpqgdagvtgrkii
    vdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglcrrvlvqvsyaigvaep
    lsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiyqktacyghfgrsefpw
    evpkklvf