PDB entry 1o90

View 1o90 on RCSB PDB site
Description: methionine adenosyltransferase complexed with a l-methionine analogous
Class: transferase
Keywords: adenosyltransferase, methionine binding, transferase
Deposited on 2002-12-10, released 2003-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.244
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylmethionine synthetase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o90a1, d1o90a2, d1o90a3
  • Chain 'B':
    Compound: s-adenosylmethionine synthetase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o90b1, d1o90b2, d1o90b3
  • Heterogens: LIS, PO4, MG, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o90A (A:)
    mngpvdglcdhslseegafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetv
    cktgmvllcgeitsmamidyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspdiaq
    cvhldrneedvgagdqglmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpd
    sktqvtvqyvqdngavipvrvhtivisvqhneditleamrealkeqvikavvpakylded
    tiyhlqpsgrfviggpqgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaar
    wvakslvkaglcrrvlvqvsyaigvaeplsisiftygtskkterellevvnknfdlrpgv
    ivrdldlkkpiyqktacyghfgrsefpwevpkklvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o90A (A:)
    gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
    midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspedvgagdqglmfgyatdete
    ecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvqyvqdngavipvrvhtivisv
    qhneditleamrealkeqvikavvpakyldedtiyhlqpsgrfviggpqgdagvtgrkii
    vdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglcrrvlvqvsyaigvaep
    lsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiyqktacyghfgrsefpw
    evpkklvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o90B (B:)
    mngpvdglcdhslseegafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetv
    cktgmvllcgeitsmamidyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspdiaq
    cvhldrneedvgagdqglmfgyatdeteecmpltivlahklntrmadlrrsgvlpwlrpd
    sktqvtvqyvqdngavipvrvhtivisvqhneditleamrealkeqvikavvpakylded
    tiyhlqpsgrfviggpqgdagvtgrkiivdtyggwgahgggafsgkdytkvdrsaayaar
    wvakslvkaglcrrvlvqvsyaigvaeplsisiftygtskkterellevvnknfdlrpgv
    ivrdldlkkpiyqktacyghfgrsefpwevpkklvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o90B (B:)
    gafmftsesvgeghpdkicdqisdavldahlkqdpnakvacetvcktgmvllcgeitsma
    midyqrvvrdtikhigyddsakgfdfktcnvlvaleqqspedvgagdqglmfgyatdete
    ecmpltivlahklntrmadlrrsgvlpwlrpdsktqvtvqyvqdngavipvrvhtivisv
    qhneditleamrealkeqvikavvpakyldedtiyhlqpsgrfviggpqgdagvtgrkii
    vdtyggwgahgggafsgkdytkvdrsaayaarwvakslvkaglcrrvlvqvsyaigvaep
    lsisiftygtskkterellevvnknfdlrpgvivrdldlkkpiyqktacyghfgrsefpw
    evpkklvf