PDB entry 1o7n

View 1o7n on RCSB PDB site
Description: naphthalene 1,2-dioxygenase, ternary complex with dioxygen and indole
Class: oxidoreductase
Keywords: oxidoreductase, non-heme iron dioxygenase, enzyme-substrate complex, iron-sulfur, aromatic hydrocarbon catabolism
Deposited on 2002-11-11, released 2003-02-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.19
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Naphthalene 1,2-dioxygenase alpha subunit
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1o7na1, d1o7na2
  • Chain 'B':
    Compound: Naphthalene 1,2-dioxygenase beta subunit
    Species: PSEUDOMONAS PUTIDA [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1o7nb_
  • Heterogens: EDO, IND, OXY, SO4, FES, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o7nA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7nA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o7nB (B:)
    mminiqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgs
    evqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfi
    tnvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdy
    perilqthnlmvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7nB (B:)
    miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
    vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
    nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
    erilqthnlmvfl