PDB entry 1o7g

View 1o7g on RCSB PDB site
Description: naphthalene 1,2-dioxygenase with naphthalene bound in the active site.
Deposited on 2002-11-05, released 2003-02-20
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-20, with a file datestamp of 2003-02-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.163
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o7gA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7gA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtfgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o7gB (B:)
    mminiqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgs
    evqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfi
    tnvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdy
    perilqthnlmvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o7gB (B:)
    miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
    vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
    nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
    erilqthnlmvfl