PDB entry 1o6y

View 1o6y on RCSB PDB site
Description: catalytic domain of pknb kinase from mycobacterium tuberculosis
Class: transferase
Keywords: serine/threonine protein kinase, transferase,psi,protein structure initiative,tb structural genomics consortium,tb, tbsgc
Deposited on 2002-10-21, released 2003-01-30
The last revision prior to the SCOP 1.75 freeze date was dated 2005-02-03, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable serine/threonine-protein kinase
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1o6ya_
  • Heterogens: MG, ACP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o6yA (A:)
    mgsshhhhhhssglvprgshmttpshlsdryelgeilgfggmsevhlardlrlhrdvavk
    vlradlardpsfylrfrreaqnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtl
    rdivhtegpmtpkraieviadacqalnfshqngiihrdvkpanimisatnavkvmdfgia
    raiadsgnsvtqtaavigtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgds
    pvsvayqhvredpippsarheglsadldavvlkalaknpenryqtaaemradlvrvhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o6yA (A:)
    tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
    aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
    cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiaqylspeqargdsvdarsd
    vyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalakn
    penryqtaaemradlvrvhng