PDB entry 1o6l

View 1o6l on RCSB PDB site
Description: crystal structure of an activated akt/protein kinase b (pkb-pif chimera) ternary complex with amp-pnp and gsk3 peptide
Deposited on 2002-10-08, released 2002-11-19
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-19, with a file datestamp of 2002-11-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.198
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1o6la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o6lA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsititppdrydslglleldqreeqemfedfdyiadw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o6lA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsitqemfedfdyiadw