PDB entry 1o6k

View 1o6k on RCSB PDB site
Description: structure of activated form of pkb kinase domain s474d with gsk3 peptide and amp-pnp
Class: transferase
Keywords: protein kinase, transferase, serine/threonine-protein kinase
Deposited on 2002-10-08, released 2002-11-19
The last revision prior to the SCOP 1.73 freeze date was dated 2002-11-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rac-beta serine/threonine protein kinase
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31751 (0-End)
      • engineered mutation (328)
    Domains in SCOP 1.73: d1o6ka_
  • Chain 'C':
    Compound: Glycogen synthase kinase-3 beta
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o6kA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsititppdrydslglleldqrthfpqfdysasire
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o6kA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesrvlq
    ntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaley
    lhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevledn
    dygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeaksllagll
    kkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfddefta
    qsitqrthfpqfdysasi
    

  • Chain 'C':
    No sequence available.