PDB entry 1o5w

View 1o5w on RCSB PDB site
Description: The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase A
Class: Oxidoreductase
Keywords: Oxidoreductase
Deposited on 2003-10-06, released 2004-04-20
The last revision prior to the SCOP 1.75 freeze date was dated 2004-04-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amine oxidase [flavin-containing] A
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21396
      • see remark 999 (24-25)
      • see remark 999 (368)
    Domains in SCOP 1.75: d1o5wa1, d1o5wa2
  • Chain 'B':
    Compound: Amine oxidase [flavin-containing] A
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21396
      • see remark 999 (24-25)
      • see remark 999 (368)
    Domains in SCOP 1.75: d1o5wb1, d1o5wb2
  • Chain 'C':
    Compound: Amine oxidase [flavin-containing] A
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21396
      • see remark 999 (24-25)
      • see remark 999 (368)
    Domains in SCOP 1.75: d1o5wc1, d1o5wc2
  • Chain 'D':
    Compound: Amine oxidase [flavin-containing] A
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21396
      • see remark 999 (24-25)
      • see remark 999 (368)
    Domains in SCOP 1.75: d1o5wd1, d1o5wd2
  • Heterogens: FAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o5wA (A:)
    mghhhhhhmtdlekpnlaghmfdvvvigggisglaaakllseykinvlvleardrvggrt
    ytvrnehvkwvdvggayvgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgaf
    ppvwnplayldynnlwrtmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktare
    faylfvninvtsephevsalwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimg
    llgdkvklsspvtyidqtddniivetlnhehyeckyvisaippiltakihfkpelppern
    qliqrlpmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgf
    ilarkadrlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytayfp
    pgimtqygrvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiw
    veepeskdvpaieithtflernlpsvpgllkitgvstsvallcfvlykikklpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5wA (A:)
    aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
    vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
    tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
    salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
    tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlpmgavikcmvy
    ykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarkadrlaklhkdir
    krkicelyakvlgsqealypvhyeeknwceeqysggcytayfppgimtqygrvirqpvgr
    iyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskdvpaieitht
    flernlpsvpgllkitgvstsvallcfvlyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o5wB (B:)
    mghhhhhhmtdlekpnlaghmfdvvvigggisglaaakllseykinvlvleardrvggrt
    ytvrnehvkwvdvggayvgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgaf
    ppvwnplayldynnlwrtmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktare
    faylfvninvtsephevsalwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimg
    llgdkvklsspvtyidqtddniivetlnhehyeckyvisaippiltakihfkpelppern
    qliqrlpmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgf
    ilarkadrlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytayfp
    pgimtqygrvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiw
    veepeskdvpaieithtflernlpsvpgllkitgvstsvallcfvlykikklpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5wB (B:)
    aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
    vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
    tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
    salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
    tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlpmgavikcmvy
    ykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarkadrlaklhkdir
    krkicelyakvlgsqealypvhyeeknwceeqysggcytayfppgimtqygrvirqpvgr
    iyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskdvpaieitht
    flernlpsvpgllkitgvstsva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1o5wC (C:)
    mghhhhhhmtdlekpnlaghmfdvvvigggisglaaakllseykinvlvleardrvggrt
    ytvrnehvkwvdvggayvgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgaf
    ppvwnplayldynnlwrtmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktare
    faylfvninvtsephevsalwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimg
    llgdkvklsspvtyidqtddniivetlnhehyeckyvisaippiltakihfkpelppern
    qliqrlpmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgf
    ilarkadrlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytayfp
    pgimtqygrvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiw
    veepeskdvpaieithtflernlpsvpgllkitgvstsvallcfvlykikklpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5wC (C:)
    aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
    vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
    tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
    salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
    tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlpmgavikcmvy
    ykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarkadrlaklhkdir
    krkicelyakvlgsqealypvhyeeknwceeqysggcytayfppgimtqygrvirqpvgr
    iyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskdvpaieitht
    flernlpsvpgllkitgvstsvallcfvlyki
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1o5wD (D:)
    mghhhhhhmtdlekpnlaghmfdvvvigggisglaaakllseykinvlvleardrvggrt
    ytvrnehvkwvdvggayvgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgaf
    ppvwnplayldynnlwrtmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktare
    faylfvninvtsephevsalwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimg
    llgdkvklsspvtyidqtddniivetlnhehyeckyvisaippiltakihfkpelppern
    qliqrlpmgavikcmvyykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgf
    ilarkadrlaklhkdirkrkicelyakvlgsqealypvhyeeknwceeqysggcytayfp
    pgimtqygrvirqpvgriyfagtetatqwsgymegaveageraarevlnalgkvakkdiw
    veepeskdvpaieithtflernlpsvpgllkitgvstsvallcfvlykikklpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o5wD (D:)
    aghmfdvvvigggisglaaakllseykinvlvleardrvggrtytvrnehvkwvdvggay
    vgptqnrilrlskelgietykvnvnerlvqyvkgktypfrgafppvwnplayldynnlwr
    tmdemgkeipvdapwqarhaqewdkmtmkdlidkicwtktarefaylfvninvtsephev
    salwflwyvrqcggtarifsvtnggqerkfvggsgqvseqimgllgdkvklsspvtyidq
    tddniivetlnhehyeckyvisaippiltakihfkpelppernqliqrlpmgavikcmvy
    ykeafwkkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarkadrlaklhkdir
    krkicelyakvlgsqealypvhyeeknwceeqysggcytayfppgimtqygrvirqpvgr
    iyfagtetatqwsgymegaveageraarevlnalgkvakkdiwveepeskdvpaieitht
    flernlpsvpgllkitgvstsvallc