PDB entry 1o5u

View 1o5u on RCSB PDB site
Description: Crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 A resolution
Class: unknown function
Keywords: Cupin, novel thermotoga maritima enzyme, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, unknown function
Deposited on 2003-10-06, released 2003-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.173
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: novel Thermotoga maritima enzyme TM1112
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1112
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o5ua_
  • Chain 'B':
    Compound: novel Thermotoga maritima enzyme TM1112
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1112
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o5ub_
  • Heterogens: UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1o5uA (A:)
mgsdkihhhhhhmevkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkv
evttedgkkyviekgdlvtfpkglrcrwkvlepvrkhynlf

    Sequence, based on observed residues (ATOM records): (download) 
    >1o5uA (A:)
evkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkvevttedgkkyvie
kgdlvtfpkglrcrwkvlepvrkhynlf

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1o5uB (B:)
mgsdkihhhhhhmevkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkv
evttedgkkyviekgdlvtfpkglrcrwkvlepvrkhynlf

    Sequence, based on observed residues (ATOM records): (download) 
    >1o5uB (B:)
evkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkvevttedgkkyvie
kgdlvtfpkglrcrwkvlepvrkhynlf