PDB entry 1o4v

View 1o4v on RCSB PDB site
Description: crystal structure of the catalytic subunit of a phosphoribosylaminoimidazole mutase (tm0446) from thermotoga maritima at 1.77 a resolution
Deposited on 2003-07-11, released 2003-07-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.151
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1o4va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o4vA (A:)
    mgsdkihhhhhhvprvgiimgsdsdlpvmkqaaeileefgidyeitivsahrtpdrmfey
    aknaeergieviiagaggaahlpgmvasithlpvigvpvktstlngldslfsivqmpggv
    pvatvainnaknagilaasilgikypeiarkvkeykermkrevlekaqrleqigykeyln
    qke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4vA (A:)
    prvgiimgsdsdlpvmkqaaeileefgidyeitivsahrtpdrmfeyaknaeergievii
    agaggaahlpgmvasithlpvigvpvktstlngldslfsivqmpggvpvatvainnakna
    gilaasilgikypeiarkvkeykermkrevlekaqrleqigykeylnqk