PDB entry 1o4n

View 1o4n on RCSB PDB site
Description: crystal structure of sh2 in complex with oxalic acid.
Class: signaling protein
Keywords: sh2 domain fragment approach, signaling protein
Deposited on 2003-06-15, released 2004-02-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.209
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Homo sapiens [TaxId:9606]
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1o4na_
  • Heterogens: OXD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o4nA (A:)
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4nA (A:)
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt