PDB entry 1o4k

View 1o4k on RCSB PDB site
Description: crystal structure of sh2 in complex with pasbn.
Class: signaling protein
Keywords: sh2 domain fragment approach
Deposited on 2003-06-15, released 2004-02-17
The last revision prior to the SCOP 1.75 freeze date was dated 2004-02-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.193
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: HOMO SAPIENS
    Gene: SRC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1o4ka_
  • Heterogens: PSN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o4kA (A:)
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o4kA (A:)
    siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
    ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt