PDB entry 1o1i

View 1o1i on RCSB PDB site
Description: Cyanomet hemoglobin (A-GLY-C:V1M,L29F,H58Q; B,D:V1M,L106W)
Class: oxygen storage/transport
Keywords: heme, oxygen delivery vehicle, blood substitute
Deposited on 2002-11-19, released 2002-12-18
The last revision prior to the SCOP 1.75 freeze date was dated 2006-02-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69905 (0-140)
      • engineered (0)
      • engineered (28)
      • engineered (57)
    Domains in SCOP 1.75: d1o1ia_
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68871 (0-145)
      • engineered (0)
      • engineered (105)
    Domains in SCOP 1.75: d1o1ib_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o1iA (A:)
    mlspadktnvkaawgkvgahageygaeafermflsfpttktyfphfdlshgsaqvkgqgk
    kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
    vhasldkflasvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o1iB (B:)
    mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
    kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrlwgnvlvcvlahhfgk
    eftppvqaayqkvvagvanalahkyh