PDB entry 1o1i

View 1o1i on RCSB PDB site
Description: Cyanomet hemoglobin (A-GLY-C:V1M,L29F,H58Q; B,D:V1M,L106W)
Class: oxygen storage/transport
Keywords: heme, oxygen delivery vehicle, blood substitute, oxygen storage-transport complex
Deposited on 2002-11-19, released 2002-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemoglobin alpha chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69905 (0-140)
    • engineered (0)
    • engineered (28)
    • engineered (57)
  Domains in SCOPe 2.08: d1o1ia_
• Chain 'B':
  Compound: hemoglobin beta chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68871 (0-145)
    • engineered (0)
    • engineered (105)
  Domains in SCOPe 2.08: d1o1ib_
• Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1o1iA (A:)
  mlspadktnvkaawgkvgahageygaeafermflsfpttktyfphfdlshgsaqvkgqgk
  kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
  vhasldkflasvstvltskyr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1o1iB (B:)
  mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
  kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrlwgnvlvcvlahhfgk
  eftppvqaayqkvvagvanalahkyh