PDB entry 1o13

View 1o13 on RCSB PDB site
Description: crystal structure of a putative dinitrogenase iron-molybdenum cofactor (tm1816) from thermotoga maritima at 1.83 a resolution
Deposited on 2002-10-15, released 2002-12-18
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.207
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1o13a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o13A (A:)
    miiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenplaqdhvhgavpnfv
    kekgaelvivrgigrraiaafeamgvkvikgasgtveevvnqylsgq