PDB entry 1o12

View 1o12 on RCSB PDB site
Description: Crystal structure of N-acetylglucosamine-6-phosphate deacetylase (TM0814) from Thermotoga maritima at 2.5 A resolution
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, TM0814, N-acetylglucosamine-6-phosphate deacetylase, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics
Deposited on 2002-10-15, released 2002-12-18
The last revision prior to the SCOP 1.75 freeze date was dated 2006-03-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Thermotoga maritima
    Gene: TM0814
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZS1 (12-375)
      • modified residue (12)
      • modified residue (53)
      • modified residue (70)
      • modified residue (77)
      • modified residue (101)
      • modified residue (160)
      • modified residue (196)
      • modified residue (248)
      • modified residue (363)
    Domains in SCOP 1.75: d1o12a1, d1o12a2
  • Chain 'B':
    Compound: N-acetylglucosamine-6-phosphate deacetylase
    Species: Thermotoga maritima
    Gene: TM0814
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZS1 (12-375)
      • modified residue (12)
      • modified residue (53)
      • modified residue (70)
      • modified residue (77)
      • modified residue (101)
      • modified residue (160)
      • modified residue (196)
      • modified residue (248)
      • modified residue (363)
    Domains in SCOP 1.75: d1o12b1, d1o12b2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o12A (A:)
    mgsdkihhhhhhmivekvlivdpidgeftgdveieegkivkvekreciprgvlmpgfvdp
    hihgvvgadtmncdfsemeeflysqgvttflattvstslekmkeilrkardyilenpsts
    llgvhlegpyiskekkgahsekhirppserelseidspakmltfapeiesselllrlvkr
    divlsaghsiatfeefmkfykegvkrithfpnglkplhhreigitgaglllddvklelic
    dgvhlsremvklvykvkkangivlvtdsisaaglkdgtttlgdlvvkvkdgvprledgtl
    agstlffsqavknfrkftgcsitelakvssynscvelglddrgriaegtradlvlldedl
    nvvmtikegevvfrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o12A (A:)
    mivekvlivdpidgeftgdveieegkivkvekreciprgvlmpgfvdphihgvvgadtmn
    cdfsemeeflysqgvttflattvstslekmkeilrkardyilenpstsllgvhlegpyis
    kekkgahsekhirppserelseidspakmltfapeiesselllrlvkrdivlsaghsiat
    feefmkfykegvkrithfpnglkplhhreigitgaglllddvklelicdgvhlsremvkl
    vykvkkangivlvtdsisaaglkdgtttlgdlvvkvkdgvprledgtlagstlffsqavk
    nfrkftgcsitelakvssynscvelglddrgriaegtradlvlldedlnvvmtikegevv
    frsr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o12B (B:)
    mgsdkihhhhhhmivekvlivdpidgeftgdveieegkivkvekreciprgvlmpgfvdp
    hihgvvgadtmncdfsemeeflysqgvttflattvstslekmkeilrkardyilenpsts
    llgvhlegpyiskekkgahsekhirppserelseidspakmltfapeiesselllrlvkr
    divlsaghsiatfeefmkfykegvkrithfpnglkplhhreigitgaglllddvklelic
    dgvhlsremvklvykvkkangivlvtdsisaaglkdgtttlgdlvvkvkdgvprledgtl
    agstlffsqavknfrkftgcsitelakvssynscvelglddrgriaegtradlvlldedl
    nvvmtikegevvfrsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o12B (B:)
    mivekvlivdpidgeftgdveieegkivkvekreciprgvlmpgfvdphihgvvgadtmn
    cdfsemeeflysqgvttflattvstslekmkeilrkardyilenpstsllgvhlegpyis
    kekkgahsekhirppserelseidspakmltfapeiesselllrlvkrdivlsaghsiat
    feefmkfykegvkrithfpnglkplhhreigitgaglllddvklelicdgvhlsremvkl
    vykvkkangivlvtdsisaaglkdgtttlgdlvvkvkdgvprledgtlagstlffsqavk
    nfrkftgcsitelakvssynscvelglddrgriaegtradlvlldedlnvvmtikegevv
    frsr