PDB entry 1o0v

View 1o0v on RCSB PDB site
Description: The crystal structure of IgE Fc reveals an asymmetrically bent conformation
Class: immune system
Keywords: IgE Fc, Immunoglobulin E, IMMUNE SYSTEM
Deposited on 2002-09-06, released 2002-09-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Immunoglobulin heavy chain epsilon-1
    Species: Homo sapiens [TaxId:9606]
    Gene: IgE(ND)
    Database cross-references and differences (RAF-indexed):
    • GB AAB59424
      • engineered (44)
      • engineered (150)
    Domains in SCOPe 2.07: d1o0va1, d1o0va2, d1o0va3
  • Chain 'B':
    Compound: Immunoglobulin heavy chain epsilon-1
    Species: Homo sapiens [TaxId:9606]
    Gene: IgE(ND)
    Database cross-references and differences (RAF-indexed):
    • GB AAB59424
      • engineered (44)
      • engineered (150)
    Domains in SCOPe 2.07: d1o0vb1, d1o0vb2, d1o0vb3
  • Heterogens: NAG, BMA, MAN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o0vA (A:)
    divasrdftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdls
    tasttqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsayl
    srpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvt
    stlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkr
    tlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkd
    eficravheaaspsqtvqravsvnpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o0vA (A:)
    dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
    egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsaylsrpspf
    dlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvtstlpvg
    trdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtlacli
    qnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdeficra
    vheaaspsqtvqravsvnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o0vB (B:)
    divasrdftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdls
    tasttqegelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsayl
    srpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvt
    stlpvgtrdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkr
    tlacliqnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkd
    eficravheaaspsqtvqravsvnpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o0vB (B:)
    dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq
    egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcadsnprgvsaylsrpspf
    dlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkeekqrngtltvtstlpvg
    trdwiegetyqcrvthphlpralmrsttktsgpraapevyafatpewpgsrdkrtlacli
    qnfmpedisvqwlhnevqlpdarhsttqprktkgsgffvfsrlevtraeweqkdeficra
    vheaaspsqtvqravsvnpg