PDB entry 1o0g

View 1o0g on RCSB PDB site
Description: Solution structure of the monomeric N67D mutant of bovine seminal ribonuclease
Class: hydrolase
Keywords: alpha-beta-protein
Deposited on 2003-02-21, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-09-16, with a file datestamp of 2007-04-25.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: BOS TAURUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • engineered (66)
    Domains in SCOPe 2.07: d1o0ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o0gA (A:)
    kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv