PDB entry 1o03

View 1o03 on RCSB PDB site
Description: Structure of Pentavalent Phosphorous Intermediate of an Enzyme Catalyzed Phosphoryl transfer Reaction observed on cocrystallization with Glucose 6-phosphate
Class: isomerase
Keywords: Haloacid dehalogenase superfamily, phosphotransferase, pentavalent phosphate intermediate, ISOMERASE
Deposited on 2003-02-20, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.17
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-phosphoglucomutase
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1o03a_
  • Heterogens: G16, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1o03A (A:)
    mfkavlfdldgvitdtaeyhfrawkalaeeigingvdrqfneqlkgvsredslqkildla
    dkkvsaeefkelakrkndnyvkmiqdvspadvypgilqllkdlrsnkikialasaskngp
    fllermnltgyfdaiadpaevaaskpapdifiaaahavgvapsesigledsqagiqaikd
    sgalpigvgrpedlgddivivpdtshytleflkevwlqkqk