PDB entry 1nyk

View 1nyk on RCSB PDB site
Description: Crystal Structure of the Rieske protein from Thermus thermophilus
Class: electron transport
Keywords: beta barrel, Iron Sulfur cluster, ELECTRON TRANSPORT
Deposited on 2003-02-12, released 2003-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: 0.158
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rieske iron-sulfur protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52396 (0-End)
      • see remark 999 (127)
    Domains in SCOPe 2.07: d1nyka_
  • Chain 'B':
    Compound: Rieske iron-sulfur protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52396 (0-End)
      • see remark 999 (127)
    Domains in SCOPe 2.07: d1nykb_
  • Heterogens: MG, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nykA (A:)
    tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
    arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
    viagppprpvpqlpvrvedgvlvaageflgpvgvqasagaytwrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nykA (A:)
    tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
    arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
    viagppprpvpqlpvrvedgvlvaageflgpvgvqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nykB (B:)
    tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
    arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
    viagppprpvpqlpvrvedgvlvaageflgpvgvqasagaytwrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nykB (B:)
    tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
    arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
    viagppprpvpqlpvrvedgvlvaageflgpvgvqa