PDB entry 1nya

View 1nya on RCSB PDB site
Description: nmr solution structure of calerythrin, an ef-hand calcium-binding protein
Deposited on 2003-02-12, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nyaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nyaA (A:)
    ttaiasdrlkkrfdrwdfdgngaleradfekeaqhiaeafgkdagaaevqtlknafgglf
    dylakeagvgsdgslteeqfirvtenlifeqgeasfnrvlgpvvkgivgmcdknadgqin
    adefaawltalgmskaeaaeafnqvdtngngelsldelltavrdfhfgrldvellg