PDB entry 1nya

View 1nya on RCSB PDB site
Description: nmr solution structure of calerythrin, an ef-hand calcium-binding protein
Class: metal binding protein
Keywords: EF-hand, METAL BINDING PROTEIN
Deposited on 2003-02-12, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calerythrin
    Species: Saccharopolyspora erythraea [TaxId:1836]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06495 (0-175)
      • engineered (106-107)
    Domains in SCOPe 2.07: d1nyaa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nyaA (A:)
    ttaiasdrlkkrfdrwdfdgngaleradfekeaqhiaeafgkdagaaevqtlknafgglf
    dylakeagvgsdgslteeqfirvtenlifeqgeasfnrvlgpvvkgivgmcdknadgqin
    adefaawltalgmskaeaaeafnqvdtngngelsldelltavrdfhfgrldvellg