PDB entry 1ny5

View 1ny5 on RCSB PDB site
Description:
Deposited on 2003-02-11, released 2003-11-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-11, with a file datestamp of 2003-11-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1ny5a1, d1ny5a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1ny5b1, d1ny5b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ny5A (A:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny5A (A:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ny5B (B:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvnsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny5B (B:)
    mnvlvieddkvfrglleeylsmkgikvesaergkeaykllsekhfnvvlldlllpdvngl
    eilkwikerspetevivitghgtiktaveamkmgaydfltkpcmleeieltinkaiehrk
    lrkenellrrekdlkeeeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarli
    hklsdrskepfvalnvasiprdifeaelfgyekgaftgavsskegffeladggtlfldei
    gelsleaqakllrviesgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrl
    gvieieipplrerkediiplanhflkkfsrkyakevegftksaqelllsypwygnvrelk
    nvieravlfsegkfidrgelsclvn