PDB entry 1ny3

View 1ny3 on RCSB PDB site
Description: Crystal structure of ADP bound to MAP KAP kinase 2
Class: transferase
Keywords: MAP KAP kinase 2, MK2, ADP, kinase, ser/thr kinase, TRANSFERASE
Deposited on 2003-02-11, released 2003-10-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.259
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ny3a_
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ny3A (A:)
    mlsnsqgqsppvpfpapapppqpptpalphppaqppppppqqfpqfhvksglqikknaii
    ddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcphivri
    vdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqylhsi
    niahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlgpeky
    dkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkm
    lirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsal
    atmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ny3A (A:)
    fhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrev
    elhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdtereaseimksig
    eaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshpyyvapevlgpeky
    dkscdmwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmlirnllkt
    eptqrmtitefmnhpwimqstkvpqtplhtsrvlked