PDB entry 1nxk

View 1nxk on RCSB PDB site
Description: Crystal structure of staurosporine bound to MAP KAP kinase 2
Class: transferase
Keywords: protein kinase, mk2, phosphorylation, staurosporine, transferase
Deposited on 2003-02-10, released 2003-10-14
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.239
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49137
      • modified residue (93)
      • modified residue (137)
      • modified residue (166)
      • modified residue (245)
      • modified residue (252)
      • modified residue (274)
      • modified residue (280)
      • modified residue (299)
      • modified residue (313)
      • modified residue (319)
      • modified residue (325)
    Domains in SCOPe 2.03: d1nxka_
  • Chain 'B':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49137
      • modified residue (93)
      • modified residue (137)
      • modified residue (166)
      • modified residue (245)
      • modified residue (252)
      • modified residue (274)
      • modified residue (280)
      • modified residue (299)
      • modified residue (313)
      • modified residue (319)
      • modified residue (325)
    Domains in SCOPe 2.03: d1nxkb_
  • Chain 'C':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49137
      • modified residue (93)
      • modified residue (137)
      • modified residue (166)
      • modified residue (245)
      • modified residue (252)
      • modified residue (274)
      • modified residue (280)
      • modified residue (299)
      • modified residue (313)
      • modified residue (319)
      • modified residue (325)
      • modified residue (355)
    Domains in SCOPe 2.03: d1nxkc_
  • Chain 'D':
    Compound: MAP kinase-activated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPKAPK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49137
      • modified residue (93)
      • modified residue (137)
      • modified residue (166)
      • modified residue (245)
      • modified residue (252)
      • modified residue (274)
      • modified residue (280)
      • modified residue (299)
      • modified residue (313)
      • modified residue (319)
      • modified residue (325)
    Domains in SCOPe 2.03: d1nxkd_
  • Heterogens: SO4, STU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nxkA (A:)
    mlsnsqgqsppvpfpapapppqpptpalphppaqppppppqqfpqfhvksglqikknaii
    ddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcphivri
    vdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqylhsi
    niahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlgpeky
    dkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkm
    lirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsal
    atmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nxkA (A:)
    qfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpka
    rrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdraftereas
    eimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapevl
    gpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevs
    eevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nxkB (B:)
    mlsnsqgqsppvpfpapapppqpptpalphppaqppppppqqfpqfhvksglqikknaii
    ddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcphivri
    vdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqylhsi
    niahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlgpeky
    dkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkm
    lirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsal
    atmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nxkB (B:)
    pqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarr
    evelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafterea
    seimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyvapev
    lgpekydkscdmwslgvimyillcgyppfysgmktrirmgqyefpnpewsevseevkmli
    rnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlked
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nxkC (C:)
    mlsnsqgqsppvpfpapapppqpptpalphppaqppppppqqfpqfhvksglqikknaii
    ddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcphivri
    vdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqylhsi
    niahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlgpeky
    dkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkm
    lirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsal
    atmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nxkC (C:)
    qqfpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpk
    arrevelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqafte
    reaseimksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettpyyva
    pevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpew
    sevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwed
    vkeemt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nxkD (D:)
    mlsnsqgqsppvpfpapapppqpptpalphppaqppppppqqfpqfhvksglqikknaii
    ddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwrasqcphivri
    vdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksigeaiqylhsi
    niahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyvapevlgpeky
    dkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkm
    lirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsal
    atmrvdyeqikikkiedasnplllkrrkkaraleaaalah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nxkD (D:)
    fpqfhvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkar
    revelhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrftereasei
    mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettcytpyyvapev
    lgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsev
    seevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvl