PDB entry 1nxi

View 1nxi on RCSB PDB site
Description: Solution structure of Vibrio cholerae protein VC0424
Class: structural genomics, unknown function
Keywords: structural genomics, ab sandwich, COG 3076, ATCC no. 51394D, NESG TARGET OP3, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2003-02-10, released 2003-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein VC0424
    Species: Vibrio cholerae [TaxId:666]
    Gene: VC0424
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KUU1 (0-123)
      • expression tag (124-131)
    Domains in SCOPe 2.07: d1nxia1, d1nxia2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nxiA (A:)
    mshqddylsveelieiqkeetrdiiqalledgsdpdalyeiehhlfaedfdklekaavea
    fkmgfevleaeetededgnkllcfdatmqsaldaklideqveklvnlaekfdiiydgwgt
    yyeglehhhhhh