PDB entry 1nx2

View 1nx2 on RCSB PDB site
Description: Calpain Domain VI
Class: hydrolase
Keywords: hydrolase, calcium binding
Deposited on 2003-02-07, released 2003-08-19
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium-dependent protease, small subunit
    Species: SUS SCROFA
    Gene: CAPNS1 OR CAPN4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1nx2a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nx2A (A:)
    eevrqfrrlfaqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
    tgklgfeefkylwnnikkwqaiykqfdvdrsgtigsselpgafeaagfhlnehlysmiir
    rysdeggnmdfdnfisclvrldamfrafksldkdgtgqiqvniqewlqltmys