PDB entry 1nwe

View 1nwe on RCSB PDB site
Description: Ptp1B R47C Modified at C47 with N-[4-(2-{2-[3-(2-Bromo-acetylamino)-propionylamino]-3-hydroxy-propionylamino}-ethyl)-phenyl]-oxalamic acid
Class: hydrolase
Keywords: hydrolase, Acetylation, Phosphorylation, phospatase, phosphotyrosine mimetic
Deposited on 2003-02-06, released 2003-05-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.284
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-tyrosine phosphatase, non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031
      • engineered (31)
      • engineered (46)
      • engineered (91)
    Domains in SCOPe 2.04: d1nwea_
  • Heterogens: FG1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nweA (A:)
    memekefeqidksgswaaiyqdirheasdfpsrvaklpknknrnrycdvspfdhsriklh
    qedndyinaslikmeeaqrsyiltqgplpntvghfwemvweqksrgvvmlnrvmekgslk
    caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
    dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
    pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nweA (A:)
    emekefeqidksgswaaiyqdirheasdfpsrvaklpknknrnrycdvspfdhsriklhq
    edndyinaslikmeeaqrsyiltqgplpntvghfwemvweqksrgvvmlnrvmekgslkc
    aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
    fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
    ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshe