PDB entry 1nw2

View 1nw2 on RCSB PDB site
Description: The crystal structure of the mutant R82E of Thioredoxin from Alicyclobacillus acidocaldarius
Deposited on 2003-02-05, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nw2a_
  • Chain 'B':
    Domains in SCOP 1.67: d1nw2b_
  • Chain 'C':
    Domains in SCOP 1.67: d1nw2c_
  • Chain 'D':
    Domains in SCOP 1.67: d1nw2d_
  • Chain 'E':
    Domains in SCOP 1.67: d1nw2e_
  • Chain 'F':
    Domains in SCOP 1.67: d1nw2f_
  • Chain 'G':
    Domains in SCOP 1.67: d1nw2g_
  • Chain 'H':
    Domains in SCOP 1.67: d1nw2h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nw2A (A:)
    atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nw2B (B:)
    atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nw2C (C:)
    atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nw2D (D:)
    atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nw2E (E:)
    atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nw2F (F:)
    atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nw2G (G:)
    atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nw2H (H:)
    atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq