PDB entry 1nvs

View 1nvs on RCSB PDB site
Description: The Complex Structure Of Checkpoint Kinase Chk1/SB218078
Deposited on 2003-02-04, released 2003-04-08
The last revision prior to the SCOP 1.67 freeze date was dated 2003-04-08, with a file datestamp of 2003-04-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.232
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nvsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nvsA (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicink
    mlnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvsA (A:)
    vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmknikkeicinkmlnhenvvk
    fyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithr
    dikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepv
    dvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilven
    psaritipdikkdrwynkplkkga