PDB entry 1nvp

View 1nvp on RCSB PDB site
Description: human tfiia/tbp/dna complex
Deposited on 2003-02-04, released 2003-10-21
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nvpA (A:)
    sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
    mvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlthq
    qfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrkt
    t
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvpA (A:)
    sgivpqlqnivstvnlgckldlktialrarnaeynpkrfaavimrireprttalifssgk
    mvctgakseeqsrlaarkyarvvqklgfpakfldfkiqnmvgscdvkfpirleglvlthq
    qfssyepelfpgliyrmikprivllifvsgkvvltgakvraeiyeafeniypilkgfrkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nvpB (B:)
    ansantntvpklyrsviedvindvrdiflddgvdeqvlmelktlwenklmqsravdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvpB (B:)
    tvpklyrsviedvindvrdiflddgvdeqvlmelktlwenklm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nvpC (C:)
    gsgaedgqveeeplnseddvsdeegqelfdtenvvvcqydkihrsknkwkfhlkdgimnl
    ngrdyifskaigdaew
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvpC (C:)
    dtenvvvcqydkihrsknkwkfhlkdgimnlngrdyifskaigdaew
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nvpD (D:)
    ayqlyrnttlgnslqesldeliqsqqitpqlalqvllqfdkainaalaqrvrnrvnfrgs
    lntyrfcdnvwtfvlndvefrevtelikvdkvkivacdgkntgsntte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvpD (D:)
    yqlyrnttlgnslqesldeliqsqqitpqlalqvllqfdkainaalaqrvrnrvnfrgsl
    ntyrfcdnvwtfvlndvefrevtelikvdkvkivacd