PDB entry 1nvm

View 1nvm on RCSB PDB site
Description:
Deposited on 2003-02-04, released 2003-06-17
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-17, with a file datestamp of 2003-06-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.189
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nvma1, d1nvma2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nvmb1, d1nvmb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nvmc1, d1nvmc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nvmd1, d1nvmd2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nvme1, d1nvme2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nvmf1, d1nvmf2
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nvmg1, d1nvmg2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1nvmh1, d1nvmh2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nvmA (A:)
    mtfnpskklyisdvtlrdgshairhqytlddvraiaraldkakvdsievahgdglqgssf
    nygfgrhtdleyieavageishaqiatlllpgigsvhdlknayqagarvvrvathctead
    vskqhieyarnlgmdtvgflmmshmipaeklaeqgklmesygatciymadsggamsmndi
    rdrmrafkavlkpetqvgmhahhnlslgvansivaveegcdrvdaslagmgagagnaple
    vfiavaerlgwnhgtdlytlmdaaddivrplqdrpvrvdretlglgyagvyssflrhaei
    aaakynlktldilvelghrrmvggqedmivdvaldllaahkenra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvmA (A:)
    tfnpskklyisdvtlrdgshairhqytlddvraiaraldkakvdsievahgdglqgssfn
    ygfgrhtdleyieavageishaqiatlllpgigsvhdlknayqagarvvrvathcteadv
    skqhieyarnlgmdtvgflmmshmipaeklaeqgklmesygatciymadsggamsmndir
    drmrafkavlkpetqvgmhahhnlslgvansivaveegcdrvdaslagmgagagnaplev
    fiavaerlgwnhgtdlytlmdaaddivrplqdrpvrvdretlglgyagvyssflrhaeia
    aakynlktldilvelghrrmvggqedmivdvaldllaahk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nvmB (B:)
    mnqklkvaiigsgnigtdlmikvlrnakylemgamvgidaasdglaraqrmgvtttyagv
    egliklpefadidfvfdatsasahvqneallrqakpgirlidltpaaigpycvpvvnlee
    hlgklnvnmvtcggqatipmvaavsrvakvhyaeivasissksagpgtranideftetts
    kaieviggaakgkaiiimnpaepplimrdtvyvlsaaadqaavaasvaemvqavqayvpg
    yrlkqqvqfdvipesaplnipglgrfsglktsvflevegaahylpayagnldimtsaala
    taermaqsmlna
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nvmC (C:)
    mtfnpskklyisdvtlrdgshairhqytlddvraiaraldkakvdsievahgdglqgssf
    nygfgrhtdleyieavageishaqiatlllpgigsvhdlknayqagarvvrvathctead
    vskqhieyarnlgmdtvgflmmshmipaeklaeqgklmesygatciymadsggamsmndi
    rdrmrafkavlkpetqvgmhahhnlslgvansivaveegcdrvdaslagmgagagnaple
    vfiavaerlgwnhgtdlytlmdaaddivrplqdrpvrvdretlglgyagvyssflrhaei
    aaakynlktldilvelghrrmvggqedmivdvaldllaahkenra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvmC (C:)
    fnpskklyisdvtlrdgshairhqytlddvraiaraldkakvdsievahgdglqgssfny
    gfgrhtdleyieavageishaqiatlllpgigsvhdlknayqagarvvrvathcteadvs
    kqhieyarnlgmdtvgflmmshmipaeklaeqgklmesygatciymadsggamsmndird
    rmrafkavlkpetqvgmhahhnlslgvansivaveegcdrvdaslagmgagagnaplevf
    iavaerlgwnhgtdlytlmdaaddivrplqdrpvrvdretlglgyagvyssflrhaeiaa
    akynlktldilvelghrrmvggqedmivdvaldllaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nvmD (D:)
    mnqklkvaiigsgnigtdlmikvlrnakylemgamvgidaasdglaraqrmgvtttyagv
    egliklpefadidfvfdatsasahvqneallrqakpgirlidltpaaigpycvpvvnlee
    hlgklnvnmvtcggqatipmvaavsrvakvhyaeivasissksagpgtranideftetts
    kaieviggaakgkaiiimnpaepplimrdtvyvlsaaadqaavaasvaemvqavqayvpg
    yrlkqqvqfdvipesaplnipglgrfsglktsvflevegaahylpayagnldimtsaala
    taermaqsmlna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvmD (D:)
    qklkvaiigsgnigtdlmikvlrnakylemgamvgidaasdglaraqrmgvtttyagveg
    liklpefadidfvfdatsasahvqneallrqakpgirlidltpaaigpycvpvvnleehl
    gklnvnmvtcggqatipmvaavsrvakvhyaeivasissksagpgtranideftettska
    ieviggaakgkaiiimnpaepplimrdtvyvlsaaadqaavaasvaemvqavqayvpgyr
    lkqqvqfdvipesaplnipglgrfsglktsvflevegaahylpayagnldimtsaalata
    ermaqsml
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nvmE (E:)
    mtfnpskklyisdvtlrdgshairhqytlddvraiaraldkakvdsievahgdglqgssf
    nygfgrhtdleyieavageishaqiatlllpgigsvhdlknayqagarvvrvathctead
    vskqhieyarnlgmdtvgflmmshmipaeklaeqgklmesygatciymadsggamsmndi
    rdrmrafkavlkpetqvgmhahhnlslgvansivaveegcdrvdaslagmgagagnaple
    vfiavaerlgwnhgtdlytlmdaaddivrplqdrpvrvdretlglgyagvyssflrhaei
    aaakynlktldilvelghrrmvggqedmivdvaldllaahkenra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvmE (E:)
    tfnpskklyisdvtlrdgshairhqytlddvraiaraldkakvdsievahgdglqgssfn
    ygfgrhtdleyieavageishaqiatlllpgigsvhdlknayqagarvvrvathcteadv
    skqhieyarnlgmdtvgflmmshmipaeklaeqgklmesygatciymadsggamsmndir
    drmrafkavlkpetqvgmhahhnlslgvansivaveegcdrvdaslagmgagagnaplev
    fiavaerlgwnhgtdlytlmdaaddivrplqdrpvrvdretlglgyagvyssflrhaeia
    aakynlktldilvelghrrmvggqedmivdvaldllaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1nvmF (F:)
    mnqklkvaiigsgnigtdlmikvlrnakylemgamvgidaasdglaraqrmgvtttyagv
    egliklpefadidfvfdatsasahvqneallrqakpgirlidltpaaigpycvpvvnlee
    hlgklnvnmvtcggqatipmvaavsrvakvhyaeivasissksagpgtranideftetts
    kaieviggaakgkaiiimnpaepplimrdtvyvlsaaadqaavaasvaemvqavqayvpg
    yrlkqqvqfdvipesaplnipglgrfsglktsvflevegaahylpayagnldimtsaala
    taermaqsmlna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvmF (F:)
    klkvaiigsgnigtdlmikvlrnakylemgamvgidaasdglaraqrmgvtttyagvegl
    iklpefadidfvfdatsasahvqneallrqakpgirlidltpaaigpycvpvvnleehlg
    klnvnmvtcggqatipmvaavsrvakvhyaeivasissksagpgtranideftettskai
    eviggaakgkaiiimnpaepplimrdtvyvlsaaadqaavaasvaemvqavqayvpgyrl
    kqqvqfdvipesaplnipglgrfsglktsvflevegaahylpayagnldimtsaalatae
    rmaqsmlna
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nvmG (G:)
    mtfnpskklyisdvtlrdgshairhqytlddvraiaraldkakvdsievahgdglqgssf
    nygfgrhtdleyieavageishaqiatlllpgigsvhdlknayqagarvvrvathctead
    vskqhieyarnlgmdtvgflmmshmipaeklaeqgklmesygatciymadsggamsmndi
    rdrmrafkavlkpetqvgmhahhnlslgvansivaveegcdrvdaslagmgagagnaple
    vfiavaerlgwnhgtdlytlmdaaddivrplqdrpvrvdretlglgyagvyssflrhaei
    aaakynlktldilvelghrrmvggqedmivdvaldllaahkenra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvmG (G:)
    fnpskklyisdvtlrdgshairhqytlddvraiaraldkakvdsievahgdglqgssfny
    gfgrhtdleyieavageishaqiatlllpgigsvhdlknayqagarvvrvathcteadvs
    kqhieyarnlgmdtvgflmmshmipaeklaeqgklmesygatciymadsggamsmndird
    rmrafkavlkpetqvgmhahhnlslgvansivaveegcdrvdaslagmgagagnaplevf
    iavaerlgwnhgtdlytlmdaaddivrplqdrpvrvdretlglgyagvyssflrhaeiaa
    akynlktldilvelghrrmvggqedmivdvaldllaahk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1nvmH (H:)
    mnqklkvaiigsgnigtdlmikvlrnakylemgamvgidaasdglaraqrmgvtttyagv
    egliklpefadidfvfdatsasahvqneallrqakpgirlidltpaaigpycvpvvnlee
    hlgklnvnmvtcggqatipmvaavsrvakvhyaeivasissksagpgtranideftetts
    kaieviggaakgkaiiimnpaepplimrdtvyvlsaaadqaavaasvaemvqavqayvpg
    yrlkqqvqfdvipesaplnipglgrfsglktsvflevegaahylpayagnldimtsaala
    taermaqsmlna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nvmH (H:)
    klkvaiigsgnigtdlmikvlrnakylemgamvgidaasdglaraqrmgvtttyagvegl
    iklpefadidfvfdatsasahvqneallrqakpgirlidltpaaigpycvpvvnleehlg
    klnvnmvtcggqatipmvaavsrvakvhyaeivasissksagpgtranideftettskai
    eviggaakgkaiiimnpaepplimrdtvyvlsaaadqaavaasvaemvqavqayvpgyrl
    kqqvqfdvipesaplnipglgrfsglktsvflevegaahylpayagnldimtsaalatae
    rmaqsml