PDB entry 1nu4

View 1nu4 on RCSB PDB site
Description: U1A RNA binding domain at 1.8 angstrom resolution reveals a pre-organized C-terminal helix
Class: RNA binding protein
Keywords: RNA recognition motif, U1 small nuclear ribonucleoprotein, RNA binding domain, RNA BINDING PROTEIN
Deposited on 2003-01-30, released 2003-02-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1A RNA binding domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.05: d1nu4a_
  • Chain 'B':
    Compound: U1A RNA binding domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (Start-96)
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.05: d1nu4b_
  • Heterogens: MG, MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nu4A (A:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nu4A (A:)
    rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
    nalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nu4B (B:)
    avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
    vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nu4B (B:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakmk