PDB entry 1ntm

View 1ntm on RCSB PDB site
Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom
Class: oxidoreductase
Keywords: bc1, qcr, membrane protein, proton translocation, electron transfer, protease, mpp, mitochondrial processing peptidase, cytochrome c1, cytochrome b, rieske, iron sulfur protein, oxidoreductase
Deposited on 2003-01-30, released 2003-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.238
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntma1, d1ntma2
  • Chain 'B':
    Compound: Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntmb1, d1ntmb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntmc1, d1ntmc2
  • Chain 'D':
    Compound: cytochrome c1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntmd1, d1ntmd2
  • Chain 'E':
    Compound: Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntme1, d1ntme2
  • Chain 'F':
    Compound: Ubiquinol-cytochrome c reductase complex 14 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntmf_
  • Chain 'G':
    Compound: ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntmg_
  • Chain 'H':
    Compound: Ubiquinol-cytochrome c reductase complex 11 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntmh_
  • Chain 'I':
    Compound: ubiquinol-cytochrome c reductase 8 kda protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntmi_
  • Chain 'J':
    Compound: Ubiquinol-cytochrome c reductase complex 7.2 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ntmj_
  • Chain 'K':
    Compound: Ubiquinol-cytochrome c reductase complex 6.4 kDa protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07552 (0-End)
      • see remark 999 (21)
    Domains in SCOPe 2.06: d1ntmk_
  • Heterogens: HEM, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntmA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ntmB (B:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntmB (B:)
    vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt
    tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe
    vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq
    nhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaa
    lvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasy
    sdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvesse
    gfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfi
    del
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ntmC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntmC (C:)
    tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
    afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
    tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
    hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
    lvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilil
    alipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfll
    ilvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntmD (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntmE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ntmF (F:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntmF (F:)
    vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
    ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ntmG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntmG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ntmH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntmH (H:)
    elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
    klfnslk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ntmI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ntmJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntmJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ntmK (K:)
    mltrflgpryrqlarnwvptaqlwgavgavglvwatdwrlildwvpyingkfkkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntmK (K:)
    mltrflgpryrqlarnwvptaqlwgavgavglvwatdwrlildwvpyingk