PDB entry 1ntd

View 1ntd on RCSB PDB site
Description: structure of alcaligenes faecalis nitrite reductase mutant m150e that contains zinc
Class: oxidoreductase (nitric oxide(a))
Keywords: oxidoreductase, flavoprotein, fad, nitrate assimilation, oxidoreductase (nitric oxide(a))
Deposited on 1995-07-03, released 1996-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.172
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: NIR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (Start-342)
      • engineered (152)
    Domains in SCOPe 2.06: d1ntda1, d1ntda2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ntdA (A:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwhvvsgengaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ntdA (A:)
    taaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhamaf
    ngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilrf
    katkpgvfvyhcappgmvpwhvvsgengaimvlpreglhdgkgkaltydkiyyvgeqdfy
    vprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvliv
    hsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyayv
    nhnlieafelgaaahfkvtgewnddlmtsvlapsgt