PDB entry 1nt4

View 1nt4 on RCSB PDB site
Description: Crystal structure of Escherichia coli periplasmic glucose-1-phosphatase H18A mutant complexed with glucose-1-phosphate
Deposited on 2003-01-28, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-13, with a file datestamp of 2004-01-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.218
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nt4a_
  • Chain 'B':
    Domains in SCOP 1.67: d1nt4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nt4A (A:)
    qtvpegyqlqqvlmmsranlraplanngsvleqstpnkwpewdvpggqlttkggvlevym
    ghymrewlaeqgmvksgecpppytvyayanslqrtvataqffitgafpgcdipvhhqekm
    gtmdptfnpvitddsaafseqavaamekelsklqltdsyqllekivnykdspackekqqc
    slvdgkntfsakyqqepgvsgplkvgnslvdaftlqyyegfpmdqvawgeiksdqqwkvl
    sklkngyqdslftspevarnvakplvsyidkalvtdrtsapkitvlvghdsniaslltal
    dfkpyqlhdqnertpiggkivfqrwhdskanrdlmkieyvyqsaeqlrnadaltlqapaq
    rvtlelsgcpidadgfcpmdkfdsvlneavk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nt4B (B:)
    qtvpegyqlqqvlmmsranlraplanngsvleqstpnkwpewdvpggqlttkggvlevym
    ghymrewlaeqgmvksgecpppytvyayanslqrtvataqffitgafpgcdipvhhqekm
    gtmdptfnpvitddsaafseqavaamekelsklqltdsyqllekivnykdspackekqqc
    slvdgkntfsakyqqepgvsgplkvgnslvdaftlqyyegfpmdqvawgeiksdqqwkvl
    sklkngyqdslftspevarnvakplvsyidkalvtdrtsapkitvlvghdsniaslltal
    dfkpyqlhdqnertpiggkivfqrwhdskanrdlmkieyvyqsaeqlrnadaltlqapaq
    rvtlelsgcpidadgfcpmdkfdsvlneavk