PDB entry 1nsw

View 1nsw on RCSB PDB site
Description: The Crystal Structure of the K18G Mutant of the thioredoxin from Alicyclobacillus acidocaldarius
Class: electron transport
Keywords: Thermostability, thioredoxin, ELECTRON TRANSPORT
Deposited on 2003-01-28, released 2003-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80579 (0-104)
      • engineered (17)
    Domains in SCOPe 2.06: d1nswa_
  • Chain 'B':
    Compound: thioredoxin
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80579 (0-104)
      • engineered (17)
    Domains in SCOPe 2.06: d1nswb_
  • Chain 'C':
    Compound: thioredoxin
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80579 (0-104)
      • engineered (17)
    Domains in SCOPe 2.06: d1nswc_
  • Chain 'D':
    Compound: thioredoxin
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80579 (0-104)
      • engineered (17)
    Domains in SCOPe 2.06: d1nswd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nswA (A:)
atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nswB (B:)
atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nswC (C:)
atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nswD (D:)
atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq