PDB entry 1nsw

View 1nsw on RCSB PDB site
Description: The Crystal Structure of the K18G Mutant of the thioredoxin from Alicyclobacillus acidocaldarius
Deposited on 2003-01-28, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nswa_
  • Chain 'B':
    Domains in SCOP 1.67: d1nswb_
  • Chain 'C':
    Domains in SCOP 1.67: d1nswc_
  • Chain 'D':
    Domains in SCOP 1.67: d1nswd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nswA (A:)
    atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nswB (B:)
    atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nswC (C:)
    atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nswD (D:)
    atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq