PDB entry 1nst

View 1nst on RCSB PDB site
Description: the sulfotransferase domain of human haparin sulfate n-deacetylase/n- sulfotransferase
Deposited on 1998-09-07, released 1999-09-16
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-16, with a file datestamp of 1999-09-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.21
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1nsta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nstA (A:)
    dplwqdpcedkrhkdiwskektcdrfpklliigpqktgttalylflgmhpdlssnypsse
    tfeeiqffnghnyhkgidwymeffpipsnttsdfyfeksanyfdsevaprraaallpkak
    vltilinpadrayswyqhqrahddpvalkytfhevitagsdassklralqnrclvpgwya
    thierwlsayhanqilvldgkllrtepakvmdmvqkflgvtntidyhktlafdpkkgfwc
    qlleggktkclgkskgrkypemdldsraflkdyyrdhnielskllykmgqtlptwlredl
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nstA (A:)
    dplwqdpccdrfpklliigpqktgttalylflgmhpdlssnypssetfeeiqffnghnyh
    kgidwymeffpisdfyfeksanyfdsevaprraaallpkakvltilinpadrayswyqhq
    rahddpvalkytfhevitagsdassklralqnrclvpgwyathierwlsayhanqilvld
    gkllrtepakvmdmvqkflgvtntidyhktlafdpkkgfwcqlleggktkclgkskgrky
    pemdldsraflkdyyrdhnielskllykmgqtlptwlredlq