PDB entry 1nsg

View 1nsg on RCSB PDB site
Description: the structure of the immunophilin-immunosuppressant fkbp12-rapamycin complex interacting with human frap
Class: complex (isomerase/kinase)
Keywords: complex (isomerase/kinase), transferase, fkbp12, frap, rapamycin
Deposited on 1997-07-01, released 1998-03-18
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506-binding protein
    Species: HOMO SAPIENS
    Gene: HUMAN HIPPOCAMPAL CDNA LIBRARY
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1nsga_
  • Chain 'B':
    Compound: fkbp-rapamycin associated protein (frap)
    Species: HOMO SAPIENS
    Gene: HUMAN HIPPOCAMPAL CDNA LIBRARY
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1nsgb_
  • Heterogens: RAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsgA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsgB (B:)
    vailwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdl
    meaqewcrkymksgnvkdltqawdlyyhvfrris